SDH/QFR Ironprotein alignment


  jump to: vertical alignment  or  FASTA/PIR format

                     10        20        30        40        50        60
                      |         |         |         |         |         |
Humanx0      ------------------------PRIKKFAIYRWDPDKAGDKPHMQTYKVDLNKCG-PM
Chicken ------------------------SRIKKFSIYRWDPDKPGDKPRMQTYEVDLNKCG-PM
Sccere --------------TATTAAATHTPRLKTFKVYRWNPDEPSAKPHLQSYQVDLNDCG-PM
Pcdeni MVQLTLPKNSRMRVGKTWPKPEGATNVRRFNIYRWDPDT-GENPRIDTYFVDMDKCG-PM
ecolix2 -------------------------MRLEFSIYRYNPDV-DDAPRMQDYTLEADEGRDMM
WolinelFRD -----------------------MGRMLTIRVFKYDPQSAVSKPHFQEYKIEEAPSM--T
ecolix3 ---------------------MAEMKNLKIEVVRYNPEV-DTAPHSAFYEVPYDATT--S
: : :::*: *: * : Prim.cons. MVQLTLPKNSRMRV22T2222334PRI2KFSIYRWDPD22GDKPHMQTY2VDL2KCGDPM 70 80 90 100 110 120 | | | | | | Humanx0 VLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLNK--VSKIYP Chicken VLDALIKIKNELDSTLTFRRSCREGICGSCAMNIAGGNTLACTKKIDPDLSK--TTKIYP Sccere VLDALLKIKDEQDSTLTFRRSCREGICGSCAMNIGGRNTLACICKIDQNESK--QLKIYP Pcdeni VLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGGNHLACIYGMDEIKG---DVNIYP ecolix2 LLDALIQLK-EKDPSLSFRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRP WolinelFRD IFIVLNMIRETYDPDLNFDFVCRAGICGSCGMMINGRPSLACRTLTKDFEDG--VITLLP ecolix3 LLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDG---MKVEA :: .* :: . *.: ** .:*** .: : . *** : . Prim.cons. VLDALIKIKNELDPTLTFRRSCREGICGSCAMNINGGNTLACITKIDDN22KGKVIKIYP 130 140 150 160 170 180 | | | | | | Humanx0 LPHMYVIKDLVPDLSNFY-AQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECIL
Chicken LPHMYVVKDLVPDLSNFY-AQYKSIEPYLKKKDESKQGKEQYLQSIEDRQKLDGLYECIL
Sccere LPHMFIVKDLVPDLTNFY-QQYKSIQPYLQRSSFPKDG-TEVLQSIEDRKKLDGLYECIL
Pcdeni LPHMPVVKDLVPDLTHFY-AQHASVQPYLITETPTPDK--EWRQSIEDRKKLDGLYECVM
ecolix2 LPGLPVIRDLVVDMGQFY-AQYEKIKPYLLNNGQNPPAR-EHLQMPEQREKLDGLYECIL
WolinelFRD LPAFKLIKDLSVDTGNWFNGMSQRVESWIHAQKEHDISKLEERIEPEVAQEVFELDRCIE
ecolix3 LANFPIERDLVVDMTHFI-ESLEAIKPYIIGNSRTADQG-TNIQTPAQMAKYHQFSGCIN
*. : : :** * :: ::.:: . : : *: Prim.cons. LPHMPV2KDLVPDLTNFYNAQYKSIEPYL2K22E22DGK4EYLQSIEDR3KLDGLYECIL 190 200 210 220 230 240 | | | | | | Humanx0 CACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEER-LAKLQDPFSLYRCHTIM
Chicken CACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDYTEER-LAQLQDPFSLYRCHTIM
Sccere CACCSTSCPSYWWNQEQYLGPAVLMQAYRWLIDSRDQATKTR-KAMLNNSMSLYRCHTIM
Pcdeni CASCSTACPSYWWNGDRYLGPAALLHAYRWIIDSRDEATGER-LDSLEDPFKLYRCHTIM
ecolix2 CACCSTSCPSFWWNPDKFIGPAGLLAAYRFLIDSRDTETDSR-LDGLSDAFSVFRCHSIM
WolinelFRD CGCCIAACGTKIMR-EDFVGAAGLNRVVRFMIDPHDERTDEDYYELIGDDDGVFGCMTLL
ecolix3 CGLCYAACPQFGLN-PEFIGPAAITLAHRYNEDSRDHGKKER-MAQLNSQNGVWSCTFVG
*. * ::* . ::*.* : . *: *.:* . : . :: * : Prim.cons. CACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRD2AT3ERYLAQL2DPFSLYRCHTIM 250 260 270 | | | Humanx0 NCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV--
Chicken NCTRTCPKGLNPGKAIAEIKKMMATYKEKAAAA--
Sccere NCTRTCPKGLNPGLAIAEIKKSLAFA---------
Pcdeni NCTNTCPKGLNPAKAIASIKHMMVDRIV-------
ecolix2 NCVSVCPKGLNPTRAIGHIKSMLLQRNA-------
WolinelFRD ACHDVCPKNLPLQSKIAYLRRKMVSVN--------
ecolix3 YCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR
* .*** : * : Prim.cons. NCTRTCPKGLNPGKAIAEIKKMMAT22EKAA33PR


 1 Human  
2 Chicken
3 Sccerev
4 Pcdeni
5 ecolix2
6 WolinelFRD
7 ecolix3
Human Chick Sccer Pcdeni ecoSD WoliFR ecoSD
1 -- -- -- M1 -- -- --
2 -- -- -- V2 -- -- --
3 -- -- -- Q3 -- -- --
4 -- -- -- L4 -- -- --
5 -- -- -- T5 -- -- --
6 -- -- -- L6 -- -- --
7 -- -- -- P7 -- -- --
8 -- -- -- K8 -- -- --
9 -- -- -- N9 -- -- --
10 -- -- -- S10 -- -- --
11 -- -- -- R11 -- -- --
12 -- -- -- M12 -- -- --
13 -- -- -- R13 -- -- --
14 -- -- -- V14 -- -- --
15 -- -- T1 G15 -- -- --
16 -- -- A2 K16 -- -- --
17 A1 A1 T3 T17 -- -- --
18 Q2 Q2 T4 W18 -- -- --
19 T3 T3 A5 P19 -- -- --
20 A4 A4 A6 K20 -- -- --
21 A5 A5 A7 P21 -- -- --
22 A6 A6 T8 E22 -- -- M1
23 T7 A7 H9 G23 -- -- A2
24 A8 T8 T10 A24 -- M1 E3
25 P9 S9 P11 T25 -- G2 M4
26 R10 R10 R12 N26 M1 R3 K5
27 I11 I11 L13 V27 R2 M4 N6
28 K12 K12 K14 R28 L3 L5 L7
29 K13 K13 T15 R29 E4 T6 K8
30 F14 F14 F16 F30 F5 I7 I9
31 A15 S15 K17 N31 S6 R8 E10
32 I16 I16 V18 I32 I7 V9 V11
33 Y17 Y17 Y19 Y33 Y8 F10 V12
34 R18 R18 R20 R34 R9 K11 R13
35 W19 W19 W21 W35 Y10 Y12 Y14
36 D20 D20 N22 D36 N11 D13 N15
37 P21 P21 P23 P37 P12 P14 P16
38 D22 D22 D24 D38 D13 Q15 E17
39 K23 K23 E25 T39 V14 S16 V18
40 A24 P24 P26 -- -- A17 --
41 G25 G25 S27 G40 D15 V18 D19
42 D26 D26 A28 E41 D16 S19 T20
43 K27 K27 K29 N42 A17 K20 A21
44 P28 P28 P30 P43 P18 P21 P22
45 H29 R29 H31 R44 R19 H22 H23
46 M30 M30 L32 I45 M20 F23 S24
47 Q31 Q31 Q33 D46 Q21 Q24 A25
48 T32 T32 S34 T47 D22 E25 F26
49 Y33 Y33 Y35 Y48 Y23 Y26 Y27
50 K34 E34 Q36 F49 T24 K27 E28
51 V35 V35 V37 V50 L25 I28 V29
52 D36 D36 D38 D51 E26 E29 P30
53 L37 L37 L39 M52 A27 E30 Y31
54 N38 N38 N40 D53 D28 A31 D32
55 K39 K39 D41 K54 E29 P32 A33
56 C40 C40 C42 C55 G30 S33 T34
57 G41 G41 G43 G56 R31 M34 T35
58 -- -- -- -- D32 -- --
59 P42 P42 P44 P57 M33 -- --
60 M43 M43 M45 M58 M34 T35 S36
61 V44 V44 V46 V59 L35 I36 L37
62 L45 L45 L47 L60 L36 F37 L38
63 D46 D46 D48 D61 D37 I38 D39
64 A47 A47 A49 A62 A38 V39 A40
65 L48 L48 L50 L63 L39 L40 L41
66 I49 I49 L51 I64 I40 N41 G42
67 K50 K50 K52 K65 Q41 M42 Y43
68 I51 I51 I53 I66 L42 I43 I44
69 K52 K52 K54 K67 K43 R44 K45
70 N53 N53 D55 N68 -- E45 D46
71 E54 E54 E56 E69 E44 T46 N47
72 V55 L55 Q57 I70 K45 Y47 L48
73 D56 D56 D58 D71 D46 D48 A49
74 S57 S57 S59 P72 P47 P49 P50
75 T58 T58 T60 T73 S48 D50 D51
76 L59 L59 L61 L74 L49 L51 L52
77 T60 T60 T62 T75 S50 N52 S53
78 F61 F61 F63 F76 F51 F53 Y54
79 R62 R62 R64 R77 R52 D54 R55
80 R63 R63 R65 R78 R53 F55 W56
81 S64 S64 S66 S79 S54 V56 S57
82 C65 C65 C67 C80 C55 C57 C58 - Fe2S2
83 R66 R66 R68 R81 R56 R58 R59
84 E67 E67 E69 E82 E57 A59 M60
85 G68 G68 G70 G83 G58 G60 A61
86 I69 I69 I71 I84 V59 I61 I62
87 C70 C70 C72 C85 C60 C62 C63 - Fe2S2
88 G71 G71 G73 G86 G61 G63 G64
89 S72 S72 S74 S87 S62 S64 S65
90 C73 C73 C75 C88 D63 C65 C66 - Fe2S2
91 A74 A74 A76 A89 G64 G66 G67
92 M75 M75 M77 M90 L65 M67 M68
93 N76 N76 N78 N91 N66 M68 M69
94 I77 I77 I79 I92 M67 I69 V70
95 N78 A78 G80 D93 N68 N70 N71
96 G79 G79 G81 G94 G69 G71 N72
97 G80 G80 R82 G95 K70 R72 V73
98 N81 N81 N83 N96 N71 P73 P74
99 T82 T82 T84 H97 G72 S74 K75
100 L83 L83 L85 L98 L73 L75 L76
101 A84 A84 A86 A99 A74 A76 A77
102 C85 C85 C87 C100 C75 C77 C78 - Fe2S2
103 T86 T86 I88 I101 I76 R78 K79
104 R87 K87 C89 Y102 T77 T79 T80
105 R88 K88 K90 G103 P78 L80 F81
106 I89 I89 I91 M104 I79 T81 L82
107 D90 D90 D92 D105 S80 K82 R83
108 T91 P91 Q93 E106 A81 D83 D84
109 N92 D92 N94 I107 L82 F84 Y85
110 L93 L93 E95 K108 N83 E85 T86
111 N94 S94 S96 G109 Q84 D86 D87
112 K95 K95 K97 -- P85 G87 G88
113 -- -- -- -- G86 -- --
114 -- -- -- -- K87 -- --
115 V96 T96 Q98 D110 K88 V88 --
116 S97 T97 L99 V111 I89 I89 M89
117 K98 K98 K100 N112 V90 T90 K90
118 I99 I99 I101 I113 I91 L91 V91
119 Y100 Y100 Y102 Y114 R92 L92 E92
120 P101 P101 P103 P115 P93 P93 A93
121 L102 L102 L104 L116 L94 L94 L94
122 P103 P103 P105 P117 P95 P95 A95
123 H104 H104 H106 H118 G96 A96 N96
124 M105 M105 M107 M119 L97 F97 F97
125 Y106 Y106 F108 P120 P98 K98 P98
126 V107 V107 I109 V121 V99 L99 I99
127 I108 V108 V110 V122 I100 I100 E100
128 K109 K109 K111 K123 R101 K101 R101
129 D110 D110 D112 D124 D102 D102 D102
130 L111 L111 L113 L125 L103 L103 L103
131 V112 V112 V114 V126 V104 S104 V104
132 P113 P113 P115 P127 V105 V105 V105
133 D114 D114 D116 D128 D106 D106 D106 Plant Fdx domain
134 L115 L115 L117 L129 M107 T107 M107 Bact Fdx domain
135 S116 S116 T118 T130 G108 G108 T108
136 N117 N117 N119 H131 Q109 N109 H109
137 F118 F118 F120 F132 F110 W110 F110
138 Y119 Y119 Y121 Y133 Y111 F111 I111
139 -- -- -- -- -- N112 --
140 A120 A120 Q122 A134 A112 G113 E112
141 Q121 Q121 Q123 Q135 Q113 M114 S113
142 Y122 Y122 Y124 H136 Y114 S115 L114
143 K123 K123 K125 A137 E115 Q116 E115
144 S124 S124 S126 S138 K116 R117 A116
145 I125 I125 I127 V139 I117 V118 I117
146 E126 E126 Q128 Q140 K118 E119 K118
147 P127 P127 P129 P141 P119 S120 P119
148 Y128 Y128 Y130 Y142 Y120 W121 Y120
149 L129 L129 L131 L143 L121 I122 I121
150 K130 K130 Q132 I144 L122 H123 I122
151 K131 K131 R133 T145 N123 A124 G123
152 K132 K132 S134 E146 N124 Q125 N124
153 D133 D133 S135 T147 G125 K126 S125
154 E134 E134 F136 P148 Q126 E127 R126
155 S135 S135 P137 T149 N127 H128 T127
156 Q136 K136 K138 P150 P128 D129 A128
157 E137 Q137 D139 D151 P129 I130 D129
158 G138 G138 G140 K152 A130 S131 Q130
159 K139 K139 -- -- R131 K132 G131
160 Q140 E140 T141 -- -- L133 --
161 Q141 Q141 E142 E153 E132 E134 T132
162 Y142 Y142 V143 W154 H133 E135 N133
163 L143 L143 L144 R155 L134 R136 I134
164 Q144 Q144 Q145 Q156 Q135 I137 Q135
165 S145 S145 S146 S157 M136 E138 T136
166 I146 I146 I147 I158 P137 P139 P137
167 E147 E147 E148 E159 E138 E140 A138
168 E148 D148 D149 D160 Q139 V141 Q139
169 R149 R149 R150 R161 R140 A142 M140
170 E150 Q150 K151 K162 E141 Q143 A141
171 K151 K151 K152 K163 K142 E144 K142
172 L152 L152 L153 L164 L143 V145 Y143
173 D153 D153 D154 D165 D144 F146 H144
174 G154 G154 G155 G166 G145 E147 Q145
175 L155 L155 L156 L167 L146 L148 F146
176 Y156 Y156 Y157 Y168 Y147 D149 S147
177 E157 E157 E158 E169 E148 R150 G148
178 C158 C158 C159 C170 C149 C151 C149 - Fe4S4
179 I159 I159 I160 V171 I150 I152 I150
180 L160 L160 L161 M172 L151 E153 N151
181 C161 C161 C162 C173 C152 C154 C152 - Fe4S4
182 A162 A162 A163 A174 A153 G155 G153
183 C163 C163 C164 S175 C154 C156 L154
184 C164 C164 C165 C176 C155 C157 C155 - Fe4S4
185 S165 S165 S166 S177 S156 I158 Y156
186 T166 T166 T167 T178 T157 A159 A157
187 S167 S167 S168 A179 S158 A160 A158
188 C168 C168 C169 C180 C159 C161 C159 - Fe3S4
189 P169 P169 P170 P181 P160 G162 P160
190 S170 S170 S171 S182 S161 T163 Q161
191 Y171 Y171 Y172 Y183 F162 K164 F162
192 W172 W172 W173 W184 W163 I165 G163
193 W173 W173 W174 W185 W164 M166 L164
194 N174 N174 N175 N186 N165 R167 N165
195 G175 G175 Q176 G187 P166 -- --
196 D176 D176 E177 D188 D167 E168 P166
197 K177 K177 Q178 R189 K168 D169 E167
198 Y178 Y178 Y179 Y190 F169 F170 F168
199 L179 L179 L180 L191 I170 V171 I169
200 G180 G180 G181 G192 G171 G172 G170
201 P181 P181 P182 P193 P172 A173 P171
202 A182 A182 A183 A194 A173 A174 A172
203 V183 V183 V184 A195 G174 G175 A173
204 L184 L184 L185 L196 L175 L176 I174
205 M185 M185 M186 L197 L176 N177 T175
206 Q186 Q186 Q187 H198 A177 R178 L176
207 A187 A187 A188 A199 A178 V179 A177
208 Y188 Y188 Y189 Y200 Y179 V180 H178
209 R189 R189 R190 R201 R180 R181 R179
210 W190 W190 W191 W202 F181 F182 Y180
211 M191 M191 L192 I203 L182 M183 N181
212 I192 I192 I193 I204 I183 I184 E182
213 D193 D193 D194 D205 D184 D185 D183
214 S194 S194 S195 S206 S185 P186 S184
215 R195 R195 R196 R207 R186 H187 R185
216 D196 D196 D197 D208 D187 D188 D186
217 D197 D197 Q198 E209 T188 E189 H187
218 F198 Y198 A199 A210 E189 R190 G188
219 T199 T199 T200 T211 T190 T191 K189
220 E200 E200 K201 G212 D191 D192 K190
221 E201 E201 T202 E213 S192 E193 E191
222 R202 R202 R203 R214 R193 D194 R192
223 -- -- -- -- -- Y195 --
224 L203 L203 K204 L215 L194 Y196 M193
225 A204 A204 A205 D216 D195 E197 A194
226 K205 Q205 M206 S217 G196 L198 Q195
227 L206 L206 L207 L218 L197 I199 L196
228 Q207 Q207 N208 E219 S198 G200 N197
229 D208 D208 N209 D220 D199 D201 S198
230 P209 P209 S210 P221 A200 D202 Q199
231 F210 F210 M211 F222 F201 D203 N200
232 S211 S211 S212 K223 S202 G204 G201
233 L212 L212 L213 L224 V203 V205 V202
234 Y213 Y213 Y214 Y225 F204 F206 W203
235 R214 R214 R215 R226 R205 G207 S204
236 C215 C215 C216 C227 C206 C208 C205 - Fe3S4
237 H216 H216 H217 H228 H207 M209 T206 - carboxin resistance in Para deni
238 T217 T217 T218 T229 S208 T210 F207
239 I218 I218 I219 I230 I209 L211 V208
240 M219 M219 M220 M231 M210 L212 G209
241 N220 N220 N221 N232 N211 A213 Y210
242 C221 C221 C222 C233 C212 C214 C211 - Fe3S4
243 T222 T222 T223 T234 V213 H215 S212
244 R223 R223 R224 N235 S214 D216 E213
245 T224 T224 T225 T236 V215 V217 V214
246 C225 C225 C226 C237 C216 C218 C215 - Fe4S4
247 P226 P226 P227 P238 P217 P219 P216
248 K227 K227 K228 K239 K218 K220 K217
249 G228 G228 G229 G240 G219 N221 H218
250 L229 L229 L230 L241 L220 L222 V219
251 N230 N230 N231 N242 N221 P223 D220
252 P231 P231 P232 P243 P222 L224 P221
253 G232 G232 G233 A244 T223 Q225 A222
254 K233 K233 L234 K245 R224 S226 A223
255 A234 A234 A235 A246 A225 K227 A224
256 I235 I235 I236 I247 I226 I228 I225
257 A236 A236 A237 A248 G227 A229 Q226
258 E237 E237 E238 S249 H228 Y230 Q227
259 I238 I238 I239 I250 I229 L231 G228
260 K239 K239 K240 K251 K230 R232 K229
261 K240 K240 K241 H252 S231 R233 V230
262 M241 M241 S242 M253 M232 K234 E231
263 M242 M242 L243 M254 L233 M235 S232
264 A243 A243 A244 V255 L234 V236 S233
265 T244 T244 F245 D256 Q235 S237 K234
266 Y245 Y245 A246 R257 R236 V238 D235
267 K246 K246 -- I258 N237 N239 F236
268 E247 E247 -- V259 A238 -- L237
269 K248 K248 -- -- -- -- I238
270 K249 A249 -- -- -- -- A239
271 A250 A250 -- -- -- -- T240
272 S251 A251 -- -- -- -- L241
273 V252 A252 -- -- -- -- K242
274 -- -- -- -- -- -- P243
275 -- -- -- -- -- -- R244

>Human
----------------AQTAAATAPRIKKFAIYRWDPDKAGDKPHMQTYKVDLNKCG-PM
VLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLNK--VSKIYP
LPHMYVIKDLVPDLSNFY-AQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECIL
CACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEER-LAKLQDPFSLYRCHTIM
NCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV--
>Chicken
----------------AQTAAAATSRIKKFSIYRWDPDKPGDKPRMQTYEVDLNKCG-PM
VLDALIKIKNELDSTLTFRRSCREGICGSCAMNIAGGNTLACTKKIDPDLSK--TTKIYP
LPHMYVVKDLVPDLSNFY-AQYKSIEPYLKKKDESKQGKEQYLQSIEDRQKLDGLYECIL
CACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDYTEER-LAQLQDPFSLYRCHTIM
NCTRTCPKGLNPGKAIAEIKKMMATYKEKAAAA--
>Sccerev
--------------TATTAAATHTPRLKTFKVYRWNPDEPSAKPHLQSYQVDLNDCG-PM
VLDALLKIKDEQDSTLTFRRSCREGICGSCAMNIGGRNTLACICKIDQNESK--QLKIYP
LPHMFIVKDLVPDLTNFY-QQYKSIQPYLQRSSFPKDG-TEVLQSIEDRKKLDGLYECIL
CACCSTSCPSYWWNQEQYLGPAVLMQAYRWLIDSRDQATKTR-KAMLNNSMSLYRCHTIM
NCTRTCPKGLNPGLAIAEIKKSLAFA---------
>Pcdeni
MVQLTLPKNSRMRVGKTWPKPEGATNVRRFNIYRWDPDT-GENPRIDTYFVDMDKCG-PM
VLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGGNHLACIYGMDEIKG---DVNIYP
LPHMPVVKDLVPDLTHFY-AQHASVQPYLITETPTPDK--EWRQSIEDRKKLDGLYECVM
CASCSTACPSYWWNGDRYLGPAALLHAYRWIIDSRDEATGER-LDSLEDPFKLYRCHTIM
NCTNTCPKGLNPAKAIASIKHMMVDRIV-------
>ecolix2
-------------------------MRLEFSIYRYNPDV-DDAPRMQDYTLEADEGRDMM
LLDALIQLK-EKDPSLSFRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRP
LPGLPVIRDLVVDMGQFY-AQYEKIKPYLLNNGQNPPAR-EHLQMPEQREKLDGLYECIL
CACCSTSCPSFWWNPDKFIGPAGLLAAYRFLIDSRDTETDSR-LDGLSDAFSVFRCHSIM
NCVSVCPKGLNPTRAIGHIKSMLLQRNA-------
>WolinelFRD
-----------------------MGRMLTIRVFKYDPQSAVSKPHFQEYKIEEAPSM--T
IFIVLNMIRETYDPDLNFDFVCRAGICGSCGMMINGRPSLACRTLTKDFEDG--VITLLP
LPAFKLIKDLSVDTGNWFNGMSQRVESWIHAQKEHDISKLEERIEPEVAQEVFELDRCIE
CGCCIAACGTKIMR-EDFVGAAGLNRVVRFMIDPHDERTDEDYYELIGDDDGVFGCMTLL
ACHDVCPKNLPLQSKIAYLRRKMVSVN--------
>ecolix3
---------------------MAEMKNLKIEVVRYNPEV-DTAPHSAFYEVPYDATT--S
LLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDG---MKVEA
LANFPIERDLVVDMTHFI-ESLEAIKPYIIGNSRTADQG-TNIQTPAQMAKYHQFSGCIN
CGLCYAACPQFGLN-PEFIGPAAITLAHRYNEDSRDHGKKER-MAQLNSQNGVWSCTFVG
YCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR