Chicken sequences: searching chicken database with homologues.
(see separate HTML file for complete results, this is minimal to cover)
SU 1: (beef) entire to end of beef (446), starts with 19 of beef
UDELPTR1CPK0002P19 Length = 493 Frame = +1
This would extend before residue 1, but either different gene or bad sequ. 
Note X. In any case no homology before 19, different or truncated. Find start.
Query: 19 LDNGLRVASEQSSQPTCTVGVWIDAGSRYESEKNNGAGYFV 59
          L+NGLRVAS       CTVG+ I++GSR E++  +G  +F+
Sbjct: 37 LENGLRVASXNKFGQFCTVGLLINSGSRXEAKYLSGIAHFL 159

FM_ROS005D10-T3-1 REFORMAT of: EST0548-T3-1.seq Length = 643 Frame = +1
Query: 19  LDNGLRVASEQSSQPTCTVGVWIDAGSRYESEKNNGAGYFVEHLAFKGTKNRPGNALEKE 78
           LDNGLRVASE+SSQPTCTVGVWI AGSRYE+EKNNGAGYFVEHLAFKGTK RP  A EKE
Sbjct: 7   LDNGLRVASEESSQPTCTVGVWIGAGSRYENEKNNGAGYFVEHLAFKGTKKRPCAAFEKE 186
Query: 79  VESMGAHLNAYSTREHTAYYIKALSKDLPKAVELLADIVQNCSLEDSQIEKERDVILQEL 138
           VESMGAH N Y++RE TA+YIKALSKD+PK VELLAD+VQNC+LE+SQIEKER VILQEL
Sbjct: 187 VESMGAHFNGYTSREQTAFYIKALSKDMPKVVELLADVVQNCALEESQIEKERGVILQEL 366
Query: 139 QENDTSMRDVVFNYLHATAFQGTPLAQSVEGPSENVRKLSRADLTEYLSRHYKAPRMVLA 198
           +E D  M +V F+YLHATAFQGT LA++VEG +EN++ L+RADL  Y+  H+KAPRMVLA
Sbjct: 367 KEMDNDMTNVTFDYLHATAFQGTALARTVEGTTENIKHLTRADLASYIDTHFKAPRMVLA 546
Query: 199 AAGGLEHRQLLDLAQKHFSGLSGTY 223
           AAGG+ H++L+D A++HFSG+S TY
Sbjct: 547 AAGGISHKELVDAARQHFSGVSFTY 621
DKFZ426_26E8R1 REFORMAT of: dkfz426_26e8r1.dat   Length = 776 Frame = +3
Query: 126 QIEKERDVILQELQENDTSMRDVVFNYLHATAFQGTPLAQSVEGPSENVRKLSRADLTEY 185
           QIEKER VILQEL+E D  M +V F+YLHATAFQGT LA++VEG +EN++ L+RADL  Y
Sbjct: 3   QIEKERGVILQELKEMDNDMTNVTFDYLHATAFQGTALARTVEGTTENIKHLTRADLASY 182
Query: 186 LSRHYKAPRMVLAAAGGLEHRQLLDLAQKHFSGLSGTYDEDAVPTLSPCRFTGSQICHRE 245
           +  H+KAPRMVLAAAGG+ H++L+D A++HFSG+S TY EDAVP L  CRFTGS+I  R+
Sbjct: 183 IDTHFKAPRMVLAAAGGISHKELVDAARQHFSGVSFTYKEDAVPILPRCRFTGSEIRARD 362
Query: 246 DGLPLAHVAIAVEGPGWAHPDNVALQVANAIIGHYDCTYGGGAHLSSPLASIAATNKLCQ 305
           D LP+AHVA+AVEGPGWA PDNV L VANAIIG YD T+GGG HLSS LA++A  +KLC 
Sbjct: 363 DALPVAHVALAVEGPGWADPDNVVLHVANAIIGRYDRTFGGGKHLSSRLAALAVEHKLCH 542
Query: 306 SFQTFNICYADTGLLGAHFVCDHMSIDDMMFVLQGQWMRLCTSATESEVLRGKNLLRNAL 365
           SFQTFN  Y+DTGL G HFV D +SIDDMM   QG+WMRLCTS TESEV R KN LR+A+
Sbjct: 543 SFQTFNTSYSDTGLFGFHFVADPLSIDDMMXCAQGEWMRLCTSTTESEVKRAKNHLRSAM 722
Query: 366 VSHLDGTTPVCEDIGR 381
           V+ LDGTTPVCE IG+
Sbjct: 723 VAQLDGTTPVCETIGK 770

FM_ROS052D01-T3-1 REFORMAT of: EST4796-T3-1.seq Length = 494 Frame = -3

Query: 342 WMRLCTSATESEVLRGKNLLRNALVSHLDGTTPVCEDIGRSLLTYGRRIPLAEWESRIAE 401
           WMRLCTS TESEV R KN LR+A+V+ LDGTTPVCE IG  LL YGRRI L EW+SRI+ 
Sbjct: 492 WMRLCTSTTESEVKRAKNHLRSAMVAQLDGTTPVCETIGSHLLNYGRRISLEEWDSRISA 313
Query: 402 VDARVVREVCSKYFYDQCPAVAGFGPIEQLPDYNRIRSGMFWLRF 446
           VDAR+VR+VCSKY YD+CPA+A  GPIEQL DYNRIRSGM+W+RF
Sbjct: 312 VDARMVRDVCSKYIYDKCPALAAVGPIEQLLDYNRIRSGMYWIRF 178
--
LDNGLRVASEESSQPTCTVGVWIGAGSRYENEKNNGAGYFVEHLAFKGTKKRPCAAFEKE
VESMGAHFNGYTSREQTAFYIKALSKDMPKVVELLADVVQNCALEESQIEKERGVILQEL

QIEKERGVILQEL

KEMDNDMTNVTFDYLHATAFQGTALARTVEGTTENIKHLTRADLASYIDTHFKAPRMVLA

KEMDNDMTNVTFDYLHATAFQGTALARTVEGTTENIKHLTRADLASYIDTHFKAPRMVLA

AAGGISHKELVDAARQHFSGVSFTY

AAGGISHKELVDAARQHFSGVSFTY KEDAVPILPRCRFTGSEIRARDDALPVAHVALAVE
GPGWADPDNVVLHVANAIIGRYDRTFGGGKHLSSRLAALAVEHKLCHSFQTFNTSYSDTG
LFGFHFVADPLSIDDMMXCAQGEWMRLCTSTTESEVKRAKNHLRSAMVAQLDGTTPVCET
WMRLCTSTTESEVKRAKNHLRSAMVAQLDGTTPVCET

IG K
IG SHLLNYGRRISLEEWDSRISAVDARMVRDVCSKYIYDKCPALAAVGPIEQLLDYNRIR

SGMYWIRF
--
LDNGLRVASEESSQPTCTVGVWIGAGSRYENEKNNGAGYFVEHLAFKGTKKRPCAAFEKE
VESMGAHFNGYTSREQTAFYIKALSKDMPKVVELLADVVQNCALEESQIEKERGVILQEL
KEMDNDMTNVTFDYLHATAFQGTALARTVEGTTENIKHLTRADLASYIDTHFKAPRMVLA
AAGGISHKELVDAARQHFSGVSFTYKEDAVPILPRCRFTGSEIRARDDALPVAHVALAVE
GPGWADPDNVVLHVANAIIGRYDRTFGGGKHLSSRLAALAVEHKLCHSFQTFNTSYSDTG
LFGFHFVADPLSIDDMMXCAQGEWMRLCTSTTESEVKRAKNHLRSAMVAQLDGTTPVCET
IGSHLLNYGRRISLEEWDSRISAVDARMVRDVCSKYIYDKCPALAAVGPIEQLLDYNRIR
SGMYWIRF

subunit 2:
Only two of the hits seem to be core II, covers 126-273, 402-439(end) of bovine
need to check those est's, see if more exists but low homology?
No, For 19R1 we're using entire est except 1 base on either end
for M13F start at end (300) and work back to stop codon,
exactly where beef terminates

DKFZ426_1L19R1 REFORMAT of: dkfz426_1l19r1.dat  Length = 446 Frame = +2  (highest homology, pretty sure this is core 2)
Query: 126 VTTAPEFRRWEVAALQPQLRIDKAVALQNPQAHVIENLHAAAYRNALANSLYCPDYRIGK 185
           VTTAPEFR WEV  LQPQL++DKAVA Q+PQ  V+ENLHAAAY+ ALAN LYCPDYRIGK
Sbjct: 2   VTTAPEFRPWEVTDLQPQLKVDKAVAFQSPQVGVLENLHAAAYKTALANPLYCPDYRIGK 181
Query: 186 VTPVELHDYVQNHFTSARMALIGLGVSHPVLKQVAEQFLNIRGGLGLSGAKAKYHGGEIR 245
           +T  +LH +VQN+FTSARMAL+G+GV H  LKQVAEQFLNIR G G S AKA Y GGEIR
Sbjct: 182 ITSEQLHHFVQNNFTSARMALVGIGVKHSDLKQVAEQFLNIRSGAGTSSAKATYWGGEIR 361
Query: 246 EQNGDSLVHAALVAESAAIGSAEANAFS 273
           EQNG SLVHAA+V E AA+GSAEANAFS
Sbjct: 362 EQNGHSLVHAAVVTEGAAVGSAEANAFS 445
Sbjct:
VTTAPEFRPWEVTDLQPQLKVDKAVAFQSPQVGVLENLHAAAYKTALANPLYCPDYRIGK
ITSEQLHHFVQNNFTSARMALVGIGVKHSDLKQVAEQFLNIRSGAGTSSAKATYWGGEIR
EQNGHSLVHAAVVTEGAAVGSAEANAFS
FM_ROS057B07-M13F-1
REFORMAT of: EST5322-M13F-1.seq  check: 4084  from: 1  to: 300           Length = 300 Frame = -1
Query: 402 IDAVADADVINAAKKFVSGRKSMAASGNLGHTPFIDEL 439
           ID+V  ADV+NAAKKFVSG+KSMAASG+ G TPF+DEL
Sbjct: 300 IDSVTSADVVNAAKKFVSGKKSMAASGDXGSTPFLDEL 187
(blast -> core II)
decoding entire est in same frame gives:
IDSVTSADVVNAAKKFVSGKKSMAASGDxGSTPFLDEL0KQSRDADSEWD0LSVTRV0RNDKRVIYEFSYWRKLIWSN
CGLALIK0SAEFIKKKKK

(the rest are all core 1 or MPP)
FM_ROS005D10-T3-1 REFORMAT of: EST0548-T3-1.seq  check: -1  ...    83  2e-16
FM_ROS005D10-T3-1 REFORMAT of: EST0548-T3-1.seq check: -1 from: 1 to: 643
Length = 643 Frame = +1

Query: 27  TRLPNGLVIASLENYAPASRIGLFIKAGSRYENSNNLGTSHLLRLASSLTTKGASSFKIT 86
           T L NGL +AS E+  P   +G++I AGSRYEN  N G  + +   +   TK
Sbjct: 1   TTLDNGLRVASEESSQPTCTVGVWIGAGSRYENEKNNGAGYFVEHLAFKGTKKRPCAAFE 180

Query: 87  RGIEAVGGKLSVTSTRENMAYTVECLRDDVDILMEFLLNVTTAPEFRRWEVAALQPQLRI 146
           + +E++G   +  ++RE  A+ ++ L  D+  ++E L +V           A  + Q+
Sbjct: 181 KEVESMGAHFNGYTSREQTAFYIKALSKDMPKVVELLADVVQ-------NCALEESQIEK 339

Query: 147 DKAVALQ------NPQAHV-IENLHAAAYR-NALANSLYCPDYRIGKVTPVELHDYVQNH 198
           ++ V LQ      N   +V  + LHA A++  ALA ++      I  +T  +L  Y+  H
Sbjct: 340 ERGVILQELKEMDNDMTNVTFDYLHATAFQGTALARTVEGTTENIKHLTRADLASYIDTH 519

Query: 199 FTSARMALIGL-GVSHPVLKQVAEQ 222
           F + RM L    G+SH  L   A Q
Sbjct: 520 FKAPRMVLAAAGGISHKELVDAARQ 594
sbjct (This is closest to core 1 proteins in blast):
TTLDNGLRVASEESSQPTCTVGVWIGAGSRYENEKNNGAGYFVEHLAFKGTKKRPCAAFE
KEVESMGAHFNGYTSREQTAFYIKALSKDMPKVVELLADVVQNCALEESQIEK
ERGVILQELKEMDNDMTNVTFDYLHATAFQGTALARTVEGTTENIKHLTRADLASYIDTH
FKAPRMVLAAAGGISHKELVDAARQ
--
DKFZ426_26E8R1 REFORMAT of: dkfz426_26e8r1.dat  check: 155  ...    72  2e-13
DKFZ426_26E8R1 REFORMAT of: dkfz426_26e8r1.dat Length = 776 Frame = +3
Query: 143 QLRIDKAVALQ------NPQAHV-IENLHAAAYRN-ALANSLYCPDYRIGKVTPVELHDY 194
           Q+  ++ V LQ      N   +V  + LHA A++  ALA ++      I  +T  +L  Y
Sbjct: 3   QIEKERGVILQELKEMDNDMTNVTFDYLHATAFQGTALARTVEGTTENIKHLTRADLASY 182

Query: 195 VQNHFTSARMALIGLG-VSHPVLKQVAEQFLNIRGGLGLSGA-----KAKYHGGEIREQN 248
           +  HF + RM L   G +SH  L   A Q  +         A     + ++ G EIR ++
Sbjct: 183 IDTHFKAPRMVLAAAGGISHKELVDAARQHFSGVSFTYKEDAVPILPRCRFTGSEIRARD 362

Query: 249 GDSL--VHAALVAESAAIGSAEANAFSVLQHVLGAGPHVKRGSNATSSLYQAVAKGVHQP 306
            D+L   H AL  E       +     V   ++G       G    SS   A+A
Sbjct: 363 -DALPVAHVALAVEGPGWADPDNVVLHVANAIIGRYDRTFGGGKHLSSRLAALAVEHKLC 539

Query: 307 FDVSAFNASYSDSGLFGFYTISQAASAGDVIKAAYNQVKTIAQGNLSNPDVQAAKNKLKA 366
                FN SYSD+GLFGF+ ++   S  D++  A  +   +   + +  +V+ AKN L++
Sbjct: 540 HSFQTFNTSYSDTGLFGFHFVADPLSIDDMMXCAQGEWMRLCT-STTESEVKRAKNHLRS 716

Query: 367 GYLMSVESSEGFLDEVG 383
             +  ++ +    + +G
Sbjct: 717 AMVAQLDGTTPVCETIG 767
sbjct (this brings up mammalian core 1 proteins in blast):
QIEKERGVILQELKEMDNDMTNVTFDYLHATAFQGTALARTVEGTTENIKHLTRADLASY
IDTHFKAPRMVLAAAGGISHKELVDAARQHFSGVSFTYKEDAVPILPRCRFTGSEIRARD
DALPVAHVALAVEGPGWADPDNVVLHVANAIIGRYDRTFGGGKHLSSRLAALAVEHKLC
HSFQTFNTSYSDTGLFGFHFVADPLSIDDMMXCAQGEWMRLCTSTTESEVKRAKNHLRS
AMVAQLDGTTPVCETIG

DKFZ426_30L2R1 REFORMAT of: dkfz426_30l2r1.dat  check: 5750 ...    59  2e-09
DKFZ426_30L2R1 REFORMAT of: dkfz426_30l2r1.dat Length = 607 Frame = +3
Query: 171 ALANSLYCPDYRIGKVTPVELHDYVQNHFTSARMALIGLG-VSHPVLKQVAEQFLNIRGG 229
           ALA ++      I  +T  +L  Y+  HF + RM L   G +SH  L   A Q  +
Sbjct: 18  ALARTVEGTTENIKHLTRADLASYIDTHFKAPRMVLAAAGGISHKELVDAARQHFSGVSF 197

Query: 230 LGLSGA-----KAKYHGGEIREQNGDSL--VHAALVAESAAIGSAEANAFSVLQHVLGAG 282
                A     + ++ G EIR ++ D+L   H AL  E       +     V   ++G
Sbjct: 198 TYKEDAVPILPRCRFTGSEIRARD-DALPVAHVALAVEGPGWADPDNVVLHVANAIIGRY 374

Query: 283 PHVKRGSNATSSLYQAVAKGVHQPFDVSAFNASYSDSGLFGFYTISQAASAGDVIKAAYN 342
                G    SS   A+A           FN SYSD+GLFGF+ ++   S  D++  A
Sbjct: 375 DRTFGGGKHLSSRLAALAVEHKLCHSFQTFNTSYSDTGLFGFHFVADPLSIDDMMFCAQG 554

Query: 343 Q 343
           +
Sbjct: 555 E 557
Sbjct(blast -> core 1):
ALARTVEGTTENIKHLTRADLASYIDTHFKAPRMVLAAAGGISHKELVDAARQHFSGVSF
TYKEDAVPILPRCRFTGSEIRARD-DALPVAHVALAVEGPGWADPDNVVLHVANAIIGRY
DRTFGGGKHLSSRLAALAVEHKLCHSFQTFNTSYSDTGLFGFHFVADPLSIDDMMFCAQG
E

FM_ROS009A07-T3-1 REFORMAT of: EST905-T3-1.seq  check: 6419 ...    47  7e-06
FM_ROS009A07-T3-1 REFORMAT of: EST905-T3-1.seq check: 6419 from: 1 to: 605 Length = 605 Frame = +3
Query: 274 VLQHVLGAGPHVKRGSNATSSLYQAVAKGVHQPFDVSAFNASYSDSGLFGFYTISQAASA 333
           V   ++G       G    SS   A+A           FN SYSD+GLFGF+ ++   S
Sbjct: 126 VANAIIGRYDRTFGGGKHLSSRLAALAVEHKLCHSFQTFNTSYSDTGLFGFHFVADPLSI 305

Query: 334 GDVIKAAYNQVKTIAQGNLSNPDVQAAKNKLKAGYLMSVESSEGFLDEVGSQALAAGSYT 393
            D++  A  +   +   + +  +V+ AKN L++  +  ++ +    + +GS  L  G
Sbjct: 306 DDMMFCAQGEWMRLCT-STTESEVKRAKNHLRSAMVAQLDGTTPVCETIGSHLLNYGRRI 482

Query: 394 PPSTVLQQIDAVADADVINAAKKFVSGR-KSMAASG 428
                  +I AV    V +   K++  +  ++AA G
Sbjct: 483 SLEEWDSRISAVDARMVRDVCSKYIYDKCPALAAVG 590
Sbjct(blast ->Core 1):
VANAIIGRYDRTFGGGKHLSSRLAALAVEHKLCHSFQTFNTSYSDTGLFGFHFVADPLSI
DDMMFCAQGEWMRLCTSTTESEVKRAKNHLRSAMVAQLDGTTPVCETIGSHLLNYGRRI
SLEEWDSRISAVDARMVRDVCSKYIYDKCPALAAVG

UDELPATPK0064A3F udel.pat.pk0064.a3.f                              45  5e-05
UDELPATPK0064A3F udel.pat.pk0064.a3.f Length = 642 Frame = +3
Query: 236 KAKYHGGEIREQNGDSL--VHAALVAESAAIGSAEANAFSVLQHVLGAGPHVKRGSNATS 293
           + ++ G EIR ++ D+L   H AL  E       +     V   ++G       G    S
Sbjct: 39  RCRFTGSEIRARD-DALPVAHVALAVEGPGWADPDNVVLHVANAIIGRYDRTFGGGKHLS 215

Query: 294 SLYQAVAKGVHQPFDVSAFNASYSDSGLFGFYTISQAASAGDVIKAAYNQ 343
           S   A+A           FN SYSD+GLFGF+ ++   S  D++  A  +
Sbjct: 216 SRLAALAVEHKLCHSFQTFNTSYSDTGLFGFHFVADPLSIDDMMFCAQGE 365
Sbjct (blast -> core 1):
RCRFTGSEIRARDDALPVAHVALAVEGPGWADPDNVVLHVANAIIGRYDRTFGGGKHLS
SRLAALAVEHKLCHSFQTFNTSYSDTGLFGFHFVADPLSIDDMMFCAQGE

UDELPFT1CPK0001G5 udelpft1cpk0001g5                                33  0.12
UDELPFT1CPK0001G5 udelpft1cpk0001g5 Length = 473 Frame = +2
Query: 141 QPQLRIDKAVALQ------NPQAHV-IENLHAAAYRN-ALANSLYCPDYRIGKVTPVELH 192
           + Q+  ++ V LQ      N   +V  + LHA A++  ALA ++      I  +T  +L
Sbjct: 59  ESQIEKERGVILQELKEMDNDMTNVTFDYLHATAFQGTALARTVEGTTENIKHLTQADLA 238

Query: 193 DYVQNHFTSARMALIGL-GVSHPVL 216
            Y+  HF + RM L    G+SH  L
Sbjct: 239 SYIDTHFKAPRMVLAAAGGISHKEL 313
sbjct(Blast finds core 1):
ESQIEKERGVILQELKEMDNDMTNVTFDYLHATAFQGTALARTVEGTTENIKHLTQADLA
SYIDTHFKAPRMVLAAAGGISHKEL

UDELPTR1CPK0002P19 udelptr1cpk0002p19                              32  0.20
UDELPTR1CPK0002P19 udelptr1cpk0002p19 Length = 493 Frame = +1
Query: 27 TRLPNGLVIASLENYAPASRIGLFIKAGSRYENSNNLGTSHLL 69
          T L NGL +AS   +     +GL I +GSR E     G +H L
Sbjct: 31 TVLENGLRVASXNKFGQFCTVGLLINSGSRXEAKYLSGIAHFL 159
This had slightly higher score against core 1.
Blast search gives mammal alpha-MPP

xxxxxxxx

Chicken ISP: searching chicken database with rieske precursor from berkeley data
 

FM_ROS021A05-T3-1 REFORMAT of: EST1849-T3-1.seq  Length = 527 Frame = +1
Query: 1   MLSVAARSGPFAPYLSAAAHAVPGPLKALAPAALRAEKVVLDLKRPLLCRESMSGRSARR 60
           MLSVAARSGPFAPYLSAAAHAVPGPLKALAPAALR EKVVLDLKRPLLCRESMSGRSARR
Sbjct: 82  MLSVAARSGPFAPYLSAAAHAVPGPLKALAPAALRPEKVVLDLKRPLLCRESMSGRSARR 261

Query: 61  DLVAGISLNAPASVRYVHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATAC 120
           DLVAGISLNAPASVRYVHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATAC
Sbjct: 262 DLVAGISLNAPASVRYVHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATAC 441
Query: 121 VATAYAAKNVVTQFISSLSASADVLALS 148
           VATAYAAKNVVTQFISSLSASADVLALS
Sbjct: 442 VATAYAAKNVVTQFISSLSASADVLALS 525
UDELPATPK0053G8F udel.pat.pk0053.g8.f                             308  9e-85
 UDELPATPK0053G8F udel.pat.pk0053.g8.f         
 Length = 609  Frame = +2
Query: 66  ISLNAPASVRYVHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAY 125
           ISLNAPASVRYVHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAY
Sbjct: 2   ISLNAPASVRYVHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAY 181

Query: 126 AAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQE 185
           AAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQE
Sbjct: 182 AAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQE 361

Query: 186 AEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLG 219
           AEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLG
Sbjct: 362 AEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLG 463

UDELPATPK0008E6 udel.pat.pk0008.e6 Length = 494 Frame = -3
Query: 177 RTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPC 236
           +TQAE+    EVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPC
Sbjct: 474 QTQAEL-PGXEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPC 298

Query: 237 HGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG 272
           HGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
Sbjct: 297 HGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG 190

This confirms the entire chicken sequence we are using, with overlap in the green region.
except for residue 36 in presequence A->P
No need to assemble the sequence here as we already have it.
still,
>precursor:
MLSVAARSGPFAPYLSAAAHAVPGPLKALAPAALRPEKVVLDLKRPLLCRESMSGRSARR 60
DLVAGISLNAPASVRYVHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATAC
VATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQA
EINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSH
YDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG

>presequence(su 9):
MLSVAARSGPFAPYLSAAAHAVPGPLKALAPAALRPEKVVLDLKRPLLCRESMSGRSARR 60
DLVAGISLNAPASVRY

>Mature sequence:
VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFIS
SLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDP
QHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNL
EVPTYQFVGDDLVVVG
SU 6:
DKFZ426_11A21R1 REFORMAT of: dkfz426_11a21r1.dat check: 6685 from: 1 to: 495 Length = 495 Frame = +2
Query: 1   AGRPAVSASSRWLEGIRKWYYNAAGFNKLGLMRDDTIHENDDVKEAIRRLPENLYDDRVF 60
           A R  V+   R ++ IRKWYYNAAGFNK GLMRDDT++E+DDVKEA++RLPE+LY++R+F
Sbjct: 2   AARATVAGGGRLMDRIRKWYYNAAGFNKYGLMRDDTLYEDDDVKEALKRLPEDLYNERMF 181

Query: 61  RIKRALDLSMRQQILPKEQWTKYEEDKSYLEPYLKEVIRERKEREEWAKK 110
           RIKRALDLS++ +ILPKEQW KYEEDK YLEPYLKEVIRER ERE W KK
Sbjct: 182 RIKRALDLSLKHRILPKEQWVKYEEDKPYLEPYLKEVIRERLEREAWNKK 331
AARATVAGGGRLMDRIRKWYYNAAGFNKYGLMRDDTLYEDDDVKEALKRLPEDLYNERMF
RIKRALDLSLKHRILPKEQWVKYEEDKPYLEPYLKEVIRERLEREAWNKK
SU 7: Two separate ESTís contain the entire sequence, apparently identical
FM_ROS015D09-T3-1 REFORMAT of: EST1500-T3-1.seq check: 3585 from: 1 to: 362 Length = 362 Frame = +2
Query: 1   GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYT 60
           G  FG+L RVRH+ITYSLSPFEQRA P+ FS  +PNV RR  + + +VAPPF+  YL+Y+
Sbjct: 47  GIHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYS 226

Query: 61  WGTQEFEKSKRKNPAAYENDR 81
           WGTQEFE+ KRKNPA YEND+
Sbjct: 227 WGTQEFERLKRKNPADYENDQ 289
UDELPATPK0013B5 udel.pat.pk0013.b5 Length = 398 Frame = +1

Query: 1   GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYT 60
           G  FG+L RVRH+ITYSLSPFEQRA P+ FS  +PNV RR  + + +VAPPF+  YL+Y+
Sbjct: 25  GIHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYS 204

Query: 61  WGTQEFEKSKRKNPAAYENDR 81
           WGTQEFE+ KRKNPA YEND+
Sbjct: 205 WGTQEFERLKRKNPADYENDQ 267


GIHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYS
WGTQEFERLKRKNPADYENDQ
SU 8:
UDELPATPK0073C10F udel.pat.pk0073.c10.f  Length = 535 Frame = +1
Query: 1   GDPKEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLD 60
           G+P  EEEEEEELVDPLTT+RE CEQ EKCVKARERLELCD RVSSRS TEE CTEEL D
Sbjct: 76  GEP--EEEEEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFD 249

Query: 61  FLHARDHCVAHKLFNSLK 78
           FLHARDHCVAHKLFN LK
Sbjct: 250 FLHARDHCVAHKLFNKLK 303

GEP--EEEEEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK
SU 9:- see ISP
SU 10
UDELPNF-BPK00002B9 udelpnf-bpk00002b9 Length = 366 Frame = +2
Query: 5  LTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYENKE 63
          L  + YS LFRRTSTFALT+V+GA+ FERAFDQGADAI+EH+NEGKLWKHIKHKYE  E
Sbjct: 8  LLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASE 184
LLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASE
SU 11
UDELPATPK0035A5F udel.pat.pk0035.a5.f Length = 330 Frame = +1
(chromatin assembly factor)
Query:  14 ARNWVPTAQLWGAVGA---VG-LVSATDSRLILDWV 45
           A +W P  +LW  +G    VG L+SA+D   I  W+
Sbjct: 136 ASSWTPERRLWVVMGTXT*VGHLLSASDDHTICLWI 243
DKFZ426_9L9R1 REFORMAT of: dkfz426_9l9r1.dat Length = 658 Frame = -3
Query:   6 LGPRYRQLARNWVPTAQLWGAVGAVGLVSATDSRLILDWVP 46
                       L P W P WG + A G+ TD++++L W P
Sbjct: 146 LWPTMGSYGHQWGPRGHQWGPMAANGV--RTDTKVVL-WPP 33
WVPTASLWGAVGAVGLV
Aligning the second with other su11ís gives the motif:
(wiy)x(PA)xxxxwgxx(gas)xxg(lva)