0        10        20        30        40       
| | | | | |
Rhdbactersphaer -MSGIPHDHYEPRTGIEKWLHSRLPIVALAYDTIM
IPTPRNLNWMWIWGVVLAFCLVLQI
Paracoccus -MAGIPHDHYEPKTGFERWLHRRLPIVSLVYDTLMIPTPKNLNWWWIWGIVLAFCLVLQI
Rbcapsul -MSGIPHDHYEPKTGIEKWLHDRLPIVGLVYDTIMIPTPKNLNWWWIWGIVLAFTLVLQI
Bostaurus ---------------MTNIRKSHPLMKIVNNAFIDLPAPSNISSWWNFGSLLGICLILQI
chicken --------------MAPNIRKSHPLLKMINNSLIDLPAPSNISAWWNFGSLLAVCLMTQI
Saccharocere ----------------MAFRKSNVYLSLVNSYIIDSPQPSSINYWWNMGSLLGLCLVIQI
:: : : . :: * * .:. * * :*.. *: **
Prim.cons. MSGIPHDHYEPKTGIEKWL2K2LPIV2LV2DTI2DIPTPSN2NWWW2WGS2LAFCLVLQI

50 60 70 80 90 100
| | | | | |
Rhdbactersphaer VTGIVLAMHYTPHVDLAFASVEHIMRNVNGGFMLRYLHANGASLFFIAVYLHIFRGLYYG
Paracoccus ATGIVLVMHYTPHVDLAFASVEHIMRDVNGGYMLRYLHANGASLFFLAVYIHIFRGLYYG
Rbcapsul VTGIVLAMHYTPHVDLAFASVEHIMRDVNGGWAMRYIHANGASLFFLAVYIHIFRGLYYG
Bostaurus LTGLFLAMHYTSDTTTAFSSVTHICRDVNYGWIIRYMHANGASMFFICLYMHVGRGLYYG
chicken LTGLLLAMHYTADTSLAFSSVAHTCRNVQYGWLIRNLHANGASFFFICIFLHIGRGLYYG
Saccharocere VTGIFMAMHYSSNIELAFSSVEHIMRDVHNGYILRYLHANGASFFFMVMFMHMAKGLYYG
**:.:.***:.. **:** * *:*: *: :* :******:**: :::*: :*****
Prim.cons. VTGIVLAMHYTPHVDLAF2SVEHIMRDVNGGW2LRYLHANGASLFFIAVY3HIFRGLYYG

110 120 130 140 150 160
| | | | | |
Rhdbactersphaer SYKAPREVTWIVGMLIYLAMMATAFMGYVLPWGQMSFWGATVITGLFGAIPGIGHSIQTW
Paracoccus SYKAPREVTWIVGMLIYLMMMGTAFMGYVLPWGQMSFWGATVITGLFGAIPGVGEAIQTW
Rbcapsul SYKAPREITWIVGMVIYLLMMGTAFMGYVLPWGQMSFWGATVITGLFGAIPGIGPSIQAW
Bostaurus SYT
--FLETWNIGVILLLTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTNLVEW
chicken SYL
--YKETWNTGVILLLTLMATAFVGYVLPWGQMSFWGATVITNLFSAIPYIGHTLVEW
Saccharocere SYRSPRVTLWNVGVIIFILTIATAFLGYCCVYGQMSHWGATVITNLFSAIPFVGNDIVSW
** . * *::: : :.***:** :****.*******.*:.*** :* : *
Prim.cons. SYKAPREVTW2VG2IIYL2MMATAFMGYVLPWGQMSFWGATVIT2LF2AIPGIGHSI22W

170 180 190 200 210
| | | | |
--------
Rhdbactersphaer LLGGPAVDNATLNRFFSLHYLLPFVIAALVAIHIWAFHSTGNNNPTGVEVRRTSKAEAQK
Paracoccus LLGGPAVDNPTLNRFFSLHYLLPFVIAALVVVHIWAFHTTGNNNPTGVEVRRGSKEEAKK
Rbcapsul LLGGPAVDNATLNRFFSLHYLLPFVIAALVAIHIWAFHTTGNNNPTGVEVRRTSKADAEK
Bostaurus IWGGFSVDKATLTRFFAFHFILPFIIMAIAMVHLLFLHETGSNNPTGISS-------DV-
chicken AWGGFSVDNPTLTRFFALHFLLPFAIAGITIIHLTFLHESGSNNPLGISS-------DS-
Saccharocere LWGGFSVSNPTIQRFFALHYLVPFIIAAMVIMHLMALHIHGSSNPLGITG-------NL-
** :*.:.*: ***::*:::** * .:. :*: :* *..** *:
Prim.cons. L2GG22VDN2TLNRFF2LHYLLPFVIAALV2IH2WA2H2TG2NNPTG2EVRRTSKAEA6K

220 230 240 250 260 270
| | | | | |
Rhdbactersphaer DTVPFWPYFIIKDVFALAVVLLVFFAIVGFMPNYLGHPDNYIEANPLSTPAHIVPEWYFL
Paracoccus DTLPFWPYFVIKDLFALAVVLVVFFAIVGFMPNYLGHPDNYIEANPLVTPAHIVPEWYFL
Rbcapsul DTLPFWPYFVIKDLFALALVLLGFFAVVAYMPNYLGHPDNYVQANPLSTPAHIVPEWYFL
Bostaurus DKIPFHPYYTIKDILGALLLILALMLLVLFAPDLLGDPDNYTPANPLNTPPHIKPEWYFL
chicken DKIPFHPYYSFKDILGLTLMLTPFLTLALFSPNLLGDPENFTPANPLVTPPHIKPEWYFL
Saccharocere DRIPMHSYFIFKDLVTVFLFMLILALFVFYSPNTLGQPDNYIPGNPLVTPASIDPEWYLL
* :*: .*: :**:. :.: : .. : *: **.*:*: .*** **. * ****:*
Prim.cons. DTIPF2PYF2IKDLFALALVLLVFFA2V2FMPNYLGHPDNYIPANPLVTPAHIVPEWYFL

280 290 300 310
| ------------------ | | |
Rhdbactersphaer PFYAILRAFTADVWVVQIANFISFGIIDAKFFGVLAMFGAILVMALVPWLDTSPVRSGRY
Paracoccus PFYAILRAFTADVWVVMLVNWLSFGIIDAKFFGVIAMFGAILVMALVPWLDTSRVRSGQY
Rbcapsul PFYAILRAFAADVWVVILVDGLTFGIVDAKFFGVIAMFGAIAVMALAPWLDTSKVRSGAY
Bostaurus FAYAILRS------------------IPNKLGGVLALAFSILILALIPLLHTSKQRSMMF
chicken FAYAILRS------------------IPNKLGGVLALAASVLILFLIPFLHKSKQRTMTF
Saccharocere PFYAILRS------------------IPDKLLGVITMFAAILVLLVLPFTDRSVVRGNTF
*****: : *: **::: :: :: : * . * * :
Prim.cons. PFYAILR2FTADVWVV3LVN3LSFGII2AK2FGV2AMFGAILV2AL2PWLDTSKVRSGT2

320 330 340 350 360 370
| | | | | |
Rhdbactersphaer RPMFKIYFWLLAADFVILTWVGAQQTTFPYDWISLIASAYWFAYFLVILPILGAIEKPVA
Paracoccus RPLFKWWFWLLAVDFVVLMWVGAMPAEGIYPYIALAGSAYWFAYFLIILPLLGIIEKPDA
Rbcapsul RPKFRMWFWFLVLDFVVLTWVGAMPTEYPYDWISLIASTYWFAYFLVILPLLGATEKPEP
Bostaurus RPLSQCLFWALVADLLTLTWIGGQPVEHPYITIGQLASVLYFLLILVLMPTAGTIENKLL
chicken RPLSQTLFWLLVANLLILTWIGSQPVEHPFIIIGQMASLSYFTILLILFPTIGTLENKML
Saccharocere KVLSKFFFFIFVFNFVLLGQIGACHVEVPYVLMGQIATFIYFAYFLIIVPVISTIENVLF
: : *: :. ::: * :*. . : :. .: :* :*::.* . *:
Prim.cons. RPL2K62FWLLVADFV2LTW2GAQPVEHPY2WIG2IASAY2FAYFL2ILP2LGTIE2PL2

380 390 400
| | |
Rhdbactersphaer PPATIEEDFNAHYSPATGGTKTVVAE
Paracoccus MPQTIEEDFNAHYGPETHPAE-----
Rbcapsul IPASIEEDFNSHYG---NPAE-----
Bostaurus KW------------------------
chicken NY------------------------
Saccharocere YIGRVNK-------------------
Prim.cons. 6PATIEEDFNAHYGP2T3PAETVVAE

     Bos chick Sacchce Rb.s Parac Rb.capsul
 1    --    --    --    M1    M1    M1   
 2    --    --    --    S2    A2    S2   
 3    --    --    --    G3    G3    G3   
 4    --    --    --    I4    I4    I4   
 5    --    --    --    P5    P5    P5   
 6    --    --    --    H6    H6    H6   
 7    --    --    --    D7    D7    D7   
 8    --    --    --    H8    H8    H8   
 9    --    --    --    Y9    Y9    Y9   
 10   --    --    --    E10   E10   E10  
 11   --    --    --    P11   P11   P11  
 12   --    --    --    R12   K12   K12  
 13   --    --    --    T13   T13   T13  
 14   --    M1    --    G14   G14   G14  
 15   M1    A2    --    I15   F15   I15  
 16   T2    P3    M1 H E16   E16   E16  
 17   N3    N4    A2 H K17   R17   K17  
 18   I4    I5    F3  H W18   W18   W18  
 19   R5    R6    R4  H L19   L19   L19  
 20   K6    K7    K5  H H20   H20   H20  
 21   S7    S8    S6  H S21   R21   D21  
 22   H8    H9    N7    R22   R22   R22  
 23   P9    P10   V8 H L23   L23   L23  
 24   L10   L11   Y9  H P24   P24   P24  
 25   M11   L12   L10 H I25   I25   I25  
 26   K12   K13   S11 H V26   V26   V26  
 27   I13   M14   L12 H A27   S27   G27  
 28   V14   I15   V13 H L28   L28   L28  
 29   N15   N16   N14 H A29   V29   V29  
 30   N16   N17   S15 H Y30   Y30   Y30  
 31   A17   S18   Y16 H D31   D31   D31  
 32   F18   L19   I17 H T32   T32   T32  
 33   I19   I20   I18   I33   L33   I33  
 34   D20   D21   D19   M34   M34   M34  
 35   L21   L22   S20 I35   I35   I35  
 36   P22   P23   P21 E P36   P36   P36  
 37   A23   A24   Q22 E T37   T37   T37  
 38   P24   P25   P23 E P38   P38   P38  
 39   S25   S26   S24 R39   K39   K39  
 40   N26   N27   S25 N40   N40   N40  
 41   I27   I28   I26   L41   L41   L41  
 42   S28   S29   N27   N42   N42   N42  
 43   S29   A30   Y28   W43   W43   W43  
 44   W30   W31   W29   M44   W44   W44  
 45   W31   W32   W30   W45   W45   W45  
 46   N32   N33   N31   I46   I46   I46  
 47   F33   F34   M32   W47   W47   W47  
 48   G34   G35   G33   G48   G48   G48 Heme Gly
 49   S35   S36   S34   V49   I49   I49  
 Bos chick Sacchce Rb.s Parac Rb.capsul
 50   L36   L37   L35   V50   V50   V50  
 51   L37   L38   L36   L51   L51   L51  
 52   G38   A39   G37   A52   A52   A52  
 53   I39   V40   L38   F53   F53   F53  
 54   C40   C41   C39   C54   C54   T54  
 55   L41   L42   L40   L55   L55   L55  
 56   I42   M43   V41   V56   V56   V56  
 57   L43   T44   I42   L57   L57   L57  
 58   Q44   Q45   Q43   Q58   Q58   Q58  
 59   I45   I46   I44   I59   I59   I59  
 60   L46   L47   V45   V60   A60   V60  
 61   T47   T48   T46   T61   T61   T61 Walker S/T 
 62   G48   G49   G47   G62   G62   G62 Heme Gly
 63   L49   L50   I48   I63   I63   I63  
 64   F50   L51   F49   V64   V64   V64  
 65   L51   L52   M50   L65   L65   L65  
 66   A52   A53   A51   A66   V66   A66  
 67   M53   M54   M52   M67   M67   M67  
 68   H54   H55   H53   H68   H68   H68
 69   Y55   Y56   Y54   Y69   Y69   Y69  
 70   T56   T57   S55   T70   T70   T70  
 71   S57   A58   S56   P71   P71   P71  
 72   D58   D59   N57   H72   H72   H72  
 73   T59   T60   I58   V73   V73   V73  
 74   T60   S61   E59   D74   D74   D74  
 75   T61   L62   L60   L75   L75   L75  
 76   A62   A63   A61   A76   A76   A76  
 77   F63   F64   F62   F77   F77   F77  
 78   S64   S65   S63   A78   A78   A78  
 79   S65   S66   S64   S79   S79   S79  
 80   V66   V67   V65   V80   V80   V80  
 81   T67   A68   E66   E81   E81   E81  
 82   H68   H69   H67   H82   H82   H82  
 83   I69   T70   I68   I83   I83   I83  
 84   C70   C71   M69   M84   M84   M84  
 85   R71   R72   R70   R85   R85   R85  
 86   D72   N73   D71   N86   D86   D86  
 87   V73   V74   V72   V87   V87   V87  
 88   N74   Q75   H73   N88   N88   N88  
 89   Y75   Y76   N74   G89   G89   G89  
 90   G76   G77   G75   G90   G90   G90  
 91   W77   W78   Y76   F91   Y91   W91  
 92   I78   L79   I77   M92   M92   A92  
 93   I79   I80   L78   L93   L93   M93  
 94   R80   R81   R79   R94   R94   R94  
 95   Y81   N82   Y80   Y95   Y95   Y95  
 96   M82   L83   L81   L96   L96   I96  
 97   H83   H84   H82   H97   H97   H97  
 98   A84   A85   A83   A98   A98   A98  
 99   N85   N86   N84   N99   N99   N99  
 Bos chick Sacchce Rb.s Parac Rb.capsul
 100  G86   G87   G85   G100  G100  G100 
 101  A87   A88   A86   A101  A101  A101 
 102  S88   S89   S87   S102  S102  S102 
 103  M89   F90   F88   L103  L103  L103 
 104  F90   F91   F89   F104  F104  F104 
 105  F91   F92   F90   F105  F105  F105 
 106  I92   I93   M91   I106  L106  L106 
 107  C93   C94   V92   A107  A107  A107 
 108  L94   I95   M93   V108  V108  V108 
 109  Y95   F96   F94   Y109  Y109  Y109 
 110  M96   L97   M95   L110  I110  I110 
 111  H97   H98   H96   H111  H111  H111 
 112  V98   I99   M97   I112  I112  I112 
 113  G99   G100  A98   F113  F113  F113 
 114  R100  R101  K99   R114  R114  R114 
 115  G101  G102  G100  G115  G115  G115 
 116  L102  L103  L101  L116  L116  L116 
 117  Y103  Y104  Y102  Y117  Y117  Y117 
 118  Y104  Y105  Y103  Y118  Y118  Y118 
 119  G105  G106  G104  G119  G119  G119 
 120  S106  S107  S105  S120  S120  S120 
 121  Y107  Y108  Y106  Y121  Y121  Y121 
 122  T108  L109  R107  K122  K122  K122 
 123  --    --   S108  A123  A123  A123 
 124  --    --  P109  P124  P124  P124 
 125  F109  Y110 R110  R125  R125  R125 
 126  L110  K111  V111  E126  E126  E126 
 127  E111  E112  T112  V127  V127  I127 
 128  T112  T113  L113  T128  T128  T128 
 129  W113  W114  W114  W129  W129  W129 
 130  N114  N115  N115  I130  I130  I130 
 131  I115  T116  V116  V131  V131  V131 
 132  G116  G117  G117  G132  G132  G132 Heme Gly
 133  V117  V118  V118  M133  M133  M133 
 134  I118  I119  I119  L134  L134  V134 
 135  L119  L120  I120  I135  I135  I135 
 136  L120  L121  F121  Y136  Y136  Y136 
 137  L121  L122  I122  L137  L137  L137 
 138  T122  T123  L123  A138  M138  L138 
 139  V123  L124  T124  M139  M139  M139 
 140  M124  M125  I125  M140  M140  M140 
 141  A125  A126  A126  A141  G141  G141  A125M funi resis?
 142  T126  T127  T127  T142  T142  T142  T100I atov res pneumo
 143  A127  A128  A128  A143  A143  A143 
 144  F128  F129  F129  F144  F144  F144 
 145  M129  V130  L130  M145  M145  M145 
 146  G130  G131  G131  G146  G146  G146 Heme Gly
 147  Y131  Y132  Y132  Y147  Y147  Y147 
 148  V132  V133  C133  V148  V148  V148 
 149  L133  L134  C134  L149  L149  L149 
 Bos chick Sacchce Rb.s Parac Rb.capsul
 150  P134  P135  V135  P150  P150  P150 
 151  W135  W136  Y136  W151  W151  W151 
 152  G136  G137  G137  G152  G152  G152 ??? G137V,E uncouples? yeast 
 153  Q137  Q138  Q138  Q153  Q153  Q153 
 154  M138  M139  M139  M154  M154  M154 M129L atov-r toxop 
 155  S139  S140  S140  S155  S155  S155 
 156  F140  F141  H141  F156  F156  F156 
 157  W141  W142  W142  W157  W157  W157 
 158  G142  G143  G143  G158  G158  G158  G143A QOI-resist
 159  A143  A144  A144  A159  A159  A159 
 160  T144  T145  T145  T160  T160  T160 
 161  V145  V146  V146  V161  V161  V161 
 162  I146  I147  I147  I162  I162  I162  I120V atov-r Pneumo
 163  T147  T148  T148  T163  T163  T163  T121I atov-r Pneumo
 164  N148  N149  N149  G164  G164  G164 
 165  L149  L150  L150  L165  L165  L165  L123F atov-r Pneumo
 166  L150  F151  F151  F166  F166  F166 
 167  S151  S152  S152  G167  G167  G167  S125A atov-r Pneumo
 168  A152  A153  A153  A168  A168  A168 
 169  I153  I154  I154  I169  I169  I169 
 170  P154  P155  P155  P170  P170  P170 
 171  Y155  Y156  F156  G171  G171  G171 
 172  I156  I157  V157  I172  V172  I172 
 173  G157  G158  G158  G173  G173  G173 
 174  T158  H159  N159  H174  E174  P174 
 175  N159  T160  D160  S175  A175  S175 
 176  L160  L161  I161  I176  I176  I176 
 177  V161  V162  V162  Q177  Q177  Q177 
 178  E162  E163  S163  T178  T178  A178 
 179  W163  W164  W164  W179  W179  W179 
 180  I164  A165  L165  L180  L180  L180 
 181  W165  W166  W166  L181  L181  L181 
 182  G166  G167  G167  G182  G182  G182 
 183  G167  G168  G168  G183  G183  G183 
 184  F168  F169  F169  P184  P184  P184 
 185  S169  S170  S170  A185  A185  A185 
 186  V170  V171  V171  V186  V186  V186 
 187  D171  D172  S172  D187  D187  D187 
 188  K172  N173  N173  N188  N188  N188 
 189  A173  P174  P174  A189  P189  A189 
 190  T174  T175  T175  T190  T190  T190 
 191  L175  L176  I176  L191  L191  L191 
 192  T176  T177  Q177  N192  N192  N192 
 193  R177  R178  R178  R193  R193  R193 
 194  F178  F179  F179  F194  F194  F194 
 195  F179  F180  F180  F195  F195  F195 
 196  A180  A181  A181  S196  S196  S196 
 197  F181  L182  L182  L197  L197  L197 
 198  H182  H183  H183  H198  H198  H198 
 199  F183  F184  Y184  Y199  Y199  Y199 
 Bos chick Sacchce Rb.s Parac Rb.capsul
 200  I184  L185  L185  L200  L200  L200 
 201  L185  L186  V186  L201  L201  L201 
 202  P186  P187  P187  P202  P202  P202 
 203  F187  F188  F188  F203  F203  F203 
 204  I188  A189  I189  V204  V204  V204 
 205  I189  I190  I190  I205  I205  I205 
 206  M190  A191  A191  A206  A206  A206 
 207  A191  G192  A192  A207  A207  A207 
 208  I192  I193  M193  L208  L208  L208 
 209  A193  T194  V194  V209  V209  V209 A193V,T funi resis?
 210  M194  I195  I195  A210  V210  A210 
 211  V195  I196  M196  I211  V211  I211 
 212  H196  H197  H197  H212  H212  H212 
 213  L197  L198  L198  I213  I213  I213 
 214  L198  T199  M199  W214  W214  W214 
 215  F199  F200  A200  A215  A215  A215 
 216  L200  L201  L201  F216  F216  F216 
 217  H201  H202  H202  H217  H217  H217 
 218  E202  E203  I203  S218  T218  T218 
 219  T203  S204  H204  T219  T219  T219 
 220  G204  G205  G205  G220  G220  G220 
 221  S205  S206  S206  N221  N221  N221 
 222  N206  N207  S207  N222  N222  N222 
 223  N207  N208  N208  N223  N223  N223 
 224  P208  P209  P209  P224  P224  P224 
 225  T209  L210  L210  T225  T225  T225 
 226  G210  G211  G211  G226  G226  G226 
 227  I211  I212  I212  V227  V227  V227 
 228  S212  S213  T213  E228  E228  E228 
 229  S213  S214  G214  V229  V229  V229 
 230  --    --    --    R230  R230  R230 
 231  --    --    --    R231  R231  R231 
 232  --    --    --    T232  G232  T232 
 233  --    --    --    S233  S233  S233 
 234  --    --    --    K234  K234  K234 
 235  --    --    --    A235  E235  A235 
 236  --    --    --    E236  E236  D236 
 237  D214  D215  N215  A237  A237  A237 
 238  V215  S216  L216  Q238  K238  E238 
 239  --    --    --    K239  K239  K239 
 240  D216  D217  D217  D240  D240  D240 
 241  K217  K218  R218  T241  T241  T241 
 242  I218  I219  I219  V242  L242  L242 
 243  P219  P220  P220  P243  P243  P243 
 244  F220  F221  M221  F244  F244  F244 
 245  H221  H222  H222  W245  W245  W245 
 246  P222  P223  S223  P246  P246  P246 
 247  Y223  Y224  Y224  Y247  Y247  Y247 
 248  Y224  Y225  F225  F248  F248  F248 
 249  T225  S226  I226  I249  V249  V249 
 Bos chick Sacchce Rb.s Parac Rb.capsul
 250  I226  F227  F227  I250  I250  I250 
 251  K227  K228  K228  K251  K251  K251 
 252  D228  D229  D229  D252  D252  D252 
 253  I229  I230  L230  V253  L253  L253 
 254  L230  L231  V231  F254  F254  F254 
 255  G231  G232  T232  A255  A255  A255 
 256  A232  L233  V233  L256  L256  L256 
 257  L233  T234  F234  A257  A257  A257 
 258  L234  L235  L235  V258  V258  L258 
 259  L235  M236  F236  V259  V259  V259 
 260  I236  L237  M237  L260  L260  L260 
 261  L237  T238  L238  L261  V261  L261 
 262  A238  P239  I239  V262  V262  G262 
 263  L239  F240  L240  F263  F263  F263 
 264  M240  L241  A241  F264  F264  F264 
 265  L241  T242  L242  A265  A265  A265 
 266  L242  L243  F243  I266  I266  V266 
 267  V243  A244  V244  V267  V267  V267 
 268  L244  L245  F245  G268  G268  A268 
 269  F245  F246  Y246  F269  F269  Y269 
 270  A246  S247  S247  M270  M270  M270 
 271  P247  P248  P248  P271  P271  P271 
 272  D248  N249  N249  N272  N272  N272 
 273  L249  L250  T250  Y273  Y273  Y273 
 274  L250  L251  L251  L274  L274  L274 
 275  G251  G252  G252  G275  G275  G275 
 276  D252  D253  Q253  H276  H276  H276 
 277  P253  P254  P254  P277  P277  P277 
 278  D254  E255  D255  D278  D278  D278 
 279  N255  N256  N256  N279  N279  N279 
 280  Y256  F257  Y257  Y280  Y280  Y280 
 281  T257  T258  I258  I281  I281  V281 
 282  P258  P259  P259  E282  E282  Q282 
 283  A259  A260  G260  A283  A283  A283 
 284  N260  N261  N261  N284  N284  N284 
 285  P261  P262  P262  P285  P285  P285 
 286  L262  L263  L263  L286  L286  L286 Daldal L286Phe stabilizes c1 position? 
 287  N263  V264  V264  S287  V287  S287  \-mobility mutants at 286, 288
288  T264  T265  T265  T288  T288  T288 Brandt Y.l. T256M dead, unchnged ISP epr, Em 
 289  P265  P266  P266  P289  P289  P289  \-and Darrouzet T288S
 290  P266  P267  A267  A290  A290  A290 
 291  H267  H268  S268  H291  H291  H291 Ser268-H-bind D255 in yeast. His 268 does not in ch, prox or dist. 
 292  I268  I269  I269  I292  I292  I292  \H291 Zn-binding in Rb, H291L nearly inactive (Ventrurolli)
 293  K269  K270  D270  V293  V293  V293 
 294  P270  P271  P271  P294  P294  P294 
 295  E271  E272  E272  E295  E295  E295 
 296  W272  W273  W273  W296  W296  W296 
 297  Y273  Y274  Y274  Y297  Y297  Y297 
 298  F274  F275  L275  F298  F298  F298 
 299  L275  L276  L276  L299  L299  L299 
 Bos chick Sacchce Rb.s Parac Rb.capsul
 300  F276  F277  P277  P300  P300  P300 
 301  A277  A278  F278  F301  F301  F301 
 302  Y278  Y279  Y279  Y302  Y302  Y302 
 303  A279  A280  A280  A303  A303  A303 
 304  I280  I281  I281  I304  I304  I304 
 305  L281  L282  L282  L305  L305  L305 
 306  R282  R283  R283  R306  R306  R306 
 307  S283  S284  S284  A307  A307  A307 
 308  --    --    --    F308  F308  F308 
 309  --    --    --    T309  T309  A309 
 310  --    --    --    A310  A310  A310 
 311  --    --    --    D311  D311  D311 
 312  --    --    --    V312  V312  V312 
 313  --    --    --    W313  W313  W313 
 314  --    --    --    V314  V314  V314 
 315  --    --    --    V315  V315  V315 
 316  --    --    --    Q316  M316  I316 
 317  --    --    --    I317  L317  L317 
 318  --    --    --    A318  V318  V318 
 319  --    --    --    N319  N319  D319 
 320  --    --    --    F320  W320  G320 
 321  --    --    --    I321  L321  L321 
 322  --    --    --    S322  S322  T322 
 323  --    --    --    F323  F323  F323 
 324  --    --    --    G324  G324  G324 
 325  --    --    --    I325  I325  I325 
 326  I284  I285  I285  I326  I326  V326 
 327  P285  P286  P286  D327  D327  D327 
 328  N286  N287  D287  A328  A328  A328 
 329  K287  K288  K288  K329  K329  K329 
 330  L288  L289  L289  F330  F330  F330 
 331  G289  G290  L290  F331  F331  F331 
 332  G290  G291  G291  G332  G332  G332 
 333  V291  V292  V292  V333  V333  V333 
 334  L292  L293  I293  L334  I334  I334 
 335  A293  A294  T294  A335  A335  A335 
 336  L294  L295  M295  M336  M336  M336 
 337  A295  A296  F296  F337  F337  F337 
 338  F296  A297  A297  G338  G338  G338 
 339  S297  S298  A298  A339  A339  A339 
 340  I298  V299  I299  I340  I340  I340 
 341  L299  L300  L300  L341  L341  A341 
 342  I300  I301  V301  V342  V342  V342 
 343  L301  L302  L302  M343  M343  M343 
 344  A302  F303  L303  A344  A344  A344 
 345  L303  L304  V304  L345  L345  L345 
 346  I304  I305  L305  V346  V346  A346 
 347  P305  P306  P306  P347  P347  P347 
 348  L306  F307  F307  W348  W348  W348 
 349  L307  L308  T308  L349  L349  L349 
 Bos chick Sacchce Rb.s Parac Rb.capsul
 350  H308  H309  D309  D350  D350  D350 
 351  T309  K310  R310  T351  T351  T351 
 352  S310  S311  S311  S352  S352  S352 
 353  K311  K312  V312  P353  R353  K353 
 354  Q312  Q313  V313  V354  V354  V354 
 355  R313  R314  R314  R355  R355  R355 
 356  S314  T315  G315  S356  S356  S356 
 357  M315  M316  N316  G357  G357  G357 
 358  M316  T317  T317  R358  Q358  A358 
 359  F317  F318  F318  Y359  Y359  Y359 
 360  R318  R319  K319  R360  R360  R360 
 361  P319  P320  V320  P361  P361  P361 
 362  L320  L321  L321  M362  L362  K362 
 363  S321  S322  S322  F363  F363  F363 
 364  Q322  Q323  K323  K364  K364  R364 
 365  C323  T324  F324  I365  W365  M365 - C323 Coevolves with G:Cys45? (O.Fedrigo)
 366  L324  L325  F325  Y366  W366  W366 
 367  F325  F326  F326  F367  F367  F367 
 368  W326  W327  F327  W368  W368  W368 
 369  A327  L328  I328  L369  L369  F369 
 370  L328  L329  F329  L370  L370  L370 
 371  V329  V330  V330  A371  A371  V371 
 372  A330  A331  F331  A372  V372  L372 
 373  D331  N332  N332  D373  D373  D373 
 374  L332  L333  F333  F374  F374  F374 
 375  L333  L334  V334  V375  V375  V375 
 376  T334  I335  L335  I376  V376  V376 
 377  L335  L336  L336  L377  L377  L377 
 378  T336  T337  G337  T378  M378  T378 
 379  W337  W338  Q338  W379  W379  W379 
 380  I338  I339  I339  V380  V380  V380 
 381  G339  G340  G340  G381  G381  G381 
 382  G340  S341  A341  A382  A382  A382 
 383  Q341  Q342  C342  Q383  M383  M383 
 384  P342  P343  H343  Q384  P384  P384 
 385  V343  V344  V344  T385  A385  T385 
 386  E344  E345  E345  T386  E386  E386 
 387  H345  H346  V346  F387  G387  Y387 
 388  P346  P347  P347  P388  I388  P388 
 389  Y347  F348  Y348  Y389  Y389  Y389 
 390  I348  I349  V349  D390  P390  D390 
 391  T349  I350  L350  W391  Y391  W391 
 392  I350  I351  M351  I392  I392  I392 
 393  G351  G352  G352  S393  A393  S393 
 394  Q352  Q353  Q353  L394  L394  L394 
 395  L353  M354  I354  I395  A395  I395 
 396  A354  A355  A355  A396  G396  A396 
 397  S355  S356  T356  S397  S397  S397 
 398  V356  L357  F357  A398  A398  T398 
 399  L357  S358  I358  Y399  Y399  Y399 
 Bos chick Sacchce Rb.s Parac Rb.capsul
 400  Y358  Y359  Y359  W400  W400  W400 
 401  F359  F360  F360  F401  F401  F401 
 402  L360  T361  A361  A402  A402  A402 
 403  L361  I362  Y362  Y403  Y403  Y403 
 404  I362  L363  F363  F404  F404  F404 
 405  L363  L364  L364  L405  L405  L405 
 406  V364  I365  I365  V406  I406  V406 
 407  L365  L366  I366  I407  I407  I407 
 408  M366  F367  V367  L408  L408  L408 
 409  P367  P368  P368  P409  P409  P409 
 410  T368  T369  V369  I410  L410  L410 
 411  A369  I370  I370  L411  L411  L411 
 412  G370  G371  S371  G412  G412  G412 
 413  T371  T372  T372  A413  I413  A413 
 414  I372  L373  I373  I414  I414  T414 
 415  E373  E374  E374  E415  E415  E415 
 416  N374  N375  N375  K416  K416  K416 
 417  K375  K376  V376  P417  P417  P417 
 418  L376  M377  L377  V418  D418  E418 
 419  L377  L378  F378  A419  A419  P419 
 420  K378  N379  Y379  P420  M420  I420 
 421  W379  Y380  I380  P421  P421  P421 
 422  --    --    G381  A422  Q422  A422 
 423  --    --    R382  T423  T423  S423 
 424  --    --    V383  I424  I424  I424 
 425  --    --    N384  E425  E425  E425 
 426  --    --    K385  E426  E426  E426 
 427  --    --    --    D427  D427  D427 
 428  --    --    --    F428  F428  F428 
 429  --    --    --    N429  N429  N429 
 430  --    --    --    A430  A430  S430 
 431  --    --    --    H431  H431  H431 
 432  --    --    --    Y432  Y432  Y432 
 433  --    --    --    S433  G433  G433 
 434  --    --    --    P434  P434  --   
 435  --    --    --    A435  E435  --   
 436  --    --    --    T436  T436  --   
 437  --    --    --    G437  H437  N434 
 438  --    --    --    G438  P438  P435 
 439  --    --    --    T439  A439  A436 
 440  --    --    --    K440  E440  E437 
 441  --    --    --    T441  --    --   
 442  --    --    --    V442  --    --   
 443  --    --    --    V443  --    --   
 444  --    --    --    A444  --    --   
 445  --    --    --    E445  --    --   
 Bos chick Sacchce Rb.s Parac Rb.capsul

FASTA:
>Rhdbactersphaer
MSGIPHDHYEPRTGIEKWLHSRLPIVALAYDTIMIPTPRNLNWMWIWGVVLAFCLVLQI
VTGIVLAMHYTPHVDLAFASVEHIMRNVNGGFMLRYLHANGASLFFIAVYLHIFRGLYYG
SYKAPREVTWIVGMLIYLAMMATAFMGYVLPWGQMSFWGATVITGLFGAIPGIGHSIQTW
LLGGPAVDNATLNRFFSLHYLLPFVIAALVAIHIWAFHSTGNNNPTGVEVRRTSKAEAQK
DTVPFWPYFIIKDVFALAVVLLVFFAIVGFMPNYLGHPDNYIEANPLSTPAHIVPEWYFL
PFYAILRAFTADVWVVQIANFISFGIIDAKFFGVLAMFGAILVMALVPWLDTSPVRSGRY
RPMFKIYFWLLAADFVILTWVGAQQTTFPYDWISLIASAYWFAYFLVILPILGAIEKPVA
PPATIEEDFNAHYSPATGGTKTVVAE
>Paracoccus
MAGIPHDHYEPKTGFERWLHRRLPIVSLVYDTLMIPTPKNLNWWWIWGIVLAFCLVLQI
ATGIVLVMHYTPHVDLAFASVEHIMRDVNGGYMLRYLHANGASLFFLAVYIHIFRGLYYG
SYKAPREVTWIVGMLIYLMMMGTAFMGYVLPWGQMSFWGATVITGLFGAIPGVGEAIQTW
LLGGPAVDNPTLNRFFSLHYLLPFVIAALVVVHIWAFHTTGNNNPTGVEVRRGSKEEAKK
DTLPFWPYFVIKDLFALAVVLVVFFAIVGFMPNYLGHPDNYIEANPLVTPAHIVPEWYFL
PFYAILRAFTADVWVVMLVNWLSFGIIDAKFFGVIAMFGAILVMALVPWLDTSRVRSGQY
RPLFKWWFWLLAVDFVVLMWVGAMPAEGIYPYIALAGSAYWFAYFLIILPLLGIIEKPDA
MPQTIEEDFNAHYGPETHPAE-----
>Rbcapsul
MSGIPHDHYEPKTGIEKWLHDRLPIVGLVYDTIMIPTPKNLNWWWIWGIVLAFTLVLQI
VTGIVLAMHYTPHVDLAFASVEHIMRDVNGGWAMRYIHANGASLFFLAVYIHIFRGLYYG
SYKAPREITWIVGMVIYLLMMGTAFMGYVLPWGQMSFWGATVITGLFGAIPGIGPSIQAW
LLGGPAVDNATLNRFFSLHYLLPFVIAALVAIHIWAFHTTGNNNPTGVEVRRTSKADAEK
DTLPFWPYFVIKDLFALALVLLGFFAVVAYMPNYLGHPDNYVQANPLSTPAHIVPEWYFL
PFYAILRAFAADVWVVILVDGLTFGIVDAKFFGVIAMFGAIAVMALAPWLDTSKVRSGAY
RPKFRMWFWFLVLDFVVLTWVGAMPTEYPYDWISLIASTYWFAYFLVILPLLGATEKPEP
IPASIEEDFNSHYG---NPAE-----
>Bostaurus
--------------MTNIRKSHPLMKIVNNAFIDLPAPSNISSWWNFGSLLGICLILQI
LTGLFLAMHYTSDTTTAFSSVTHICRDVNYGWIIRYMHANGASMFFICLYMHVGRGLYYG
SYTFLET--WNIGVILLLTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTNLVEW
IWGGFSVDKATLTRFFAFHFILPFIIMAIAMVHLLFLHETGSNNPTGISS-------DV-
DKIPFHPYYTIKDILGALLLILALMLLVLFAPDLLGDPDNYTPANPLNTPPHIKPEWYFL
FAYAILRS------------------IPNKLGGVLALAFSILILALIPLLHTSKQRSMMF
RPLSQCLFWALVADLLTLTWIGGQPVEHPYITIGQLASVLYFLLILVLMPTAGTIENKLL
KW------------------------
>chicken
-------------MAPNIRKSHPLLKMINNSLIDLPAPSNISAWWNFGSLLAVCLMTQI
LTGLLLAMHYTADTSLAFSSVAHTCRNVQYGWLIRNLHANGASFFFICIFLHIGRGLYYG
SYLYKET--WNTGVILLLTLMATAFVGYVLPWGQMSFWGATVITNLFSAIPYIGHTLVEW
AWGGFSVDNPTLTRFFALHFLLPFAIAGITIIHLTFLHESGSNNPLGISS-------DS-
DKIPFHPYYSFKDILGLTLMLTPFLTLALFSPNLLGDPENFTPANPLVTPPHIKPEWYFL
FAYAILRS------------------IPNKLGGVLALAASVLILFLIPFLHKSKQRTMTF
RPLSQTLFWLLVANLLILTWIGSQPVEHPFIIIGQMASLSYFTILLILFPTIGTLENKML
NY------------------------
>Saccharocere
---------------MAFRKSNVYLSLVNSYIIDSPQPSSINYWWNMGSLLGLCLVIQI
VTGIFMAMHYSSNIELAFSSVEHIMRDVHNGYILRYLHANGASFFFMVMFMHMAKGLYYG
SYRSPRVTLWNVGVIIFILTIATAFLGYCCVYGQMSHWGATVITNLFSAIPFVGNDIVSW
LWGGFSVSNPTIQRFFALHYLVPFIIAAMVIMHLMALHIHGSSNPLGITG-------NL-
DRIPMHSYFIFKDLVTVFLFMLILALFVFYSPNTLGQPDNYIPGNPLVTPASIDPEWYLL
PFYAILRS------------------IPDKLLGVITMFAAILVLLVLPFTDRSVVRGNTF
KVLSKFFFFIFVFNFVLLGQIGACHVEVPYVLMGQIATFIYFAYFLIIVPVISTIENVLF
YIGRVNK-------------------