PDB Structure entries for Complex II and related flavoproteins
SQR structures
QFR structures
Soluble FRD structures (gamma-prbact) (epsilon-prbact) (firmicutes?)
Flavocyt c structures
L-Aspartate Oxidase structures
Tabular comparison of available SQR and QFR structures (pdf).
Which structure has the correct orientation of carboxin?
Crystallization reported in abstract submitted Oct 1998.
Preview of structure of chicken Complex II, June 2005.
Structures with OAA, 3-NP, and carboxin published in JBC 2006
Structures with OAA (hi res), malonate published in BBA 2006
Work on porcine Complex II by ZiHe Rao's group at TsingHua DaXue
Dr. Fei Sun's porcine Complex II at the icsg2006 (gunzipped)
Wolinella succinogenes flavoprotein has a cis-Asp! Model w atom labels is 2BS2, maps calculated with phases from it using SF's sf2bs2.cif. Other model is chicken complex II, superimposing the FAD domain.
Hagerhall's alignment of the small subunits.
(Key to species)
(from Hagerhall, 1997)
Structural alignment of the small subunits of mitochondrial and E. coli Complex II.
msgvaavsrl wrarrlaltc tkwsaawqtg trsfhftvdg nkrssakvsd aisaqypvvd hefdavvvga ggaglraafg lseagfntac vtklfptrsh tvaaqggina algnmeednw rwhfydtvkg sdwlgdqdai hymteqapas vvelenygmp fsrtedgkiy qrafggqslk fgkggqahrc ccvadrtghs llhtlygrsl rydtsyfvey faldllmesg ecrgvialci eervhpphqg qehchrhrsy grtyfsctsa htstgdgtam vtraglpcqd lefvqfhptg iygagclite gcrgeggili nsqgerfmer yapvakdlas rdvvsrsmtl eiregrgcgp ekdhvylqlh hlppaqlamr lpgisetami fagvdvtkep ipvlptvhyn mggiptnykg qvlrhvngqd qgvpglyacg eaacasvhga nrlganslld lvvfgracal siaescrpgd kvpsikpnag eesvmnldkl rfangsirts elrlnmqksm qshaavfrvg svlqegceki sslygdlrhl ktfdrgmvwn tdlvetlelq nlmlcalqti ygaearkesr ggprredfke rvdeydyskp iqgqqkkpfe qhwrkhtlsy vdiktgkvtl eyrpvidrtl netdcatvpp aigsy
Sequences. Alignment, wo bovine >Homo. Mature form is 29-280, 252 residues, 28,735 kDa: 1 maavvalslr rrlpattlgg aclqasrgaq taaataprik kfaiyrwdpd kagdkphmqt 61 ykvdlnkcgp mvldalikik nevdstltfr rscregicgs camninggnt lactrridtn 121 lnkvskiypl phmyvikdlv pdlsnfyaqy ksiepylkkk desqegkqqy lqsieerekl 181 dglyecilca ccstscpsyw wngdkylgpa vlmqayrwmi dsrddfteer laklqdpfsl 241 yrchtimnct rtcpkglnpg kaiaeikkmm atykekkasv >Gallus: maaavvgvslrrgvparflraglrpvrgleavhgicrgaqtaaaatsrikkfsiyrwdpd kpgdkprmqtyevdlnkcgpmvldalikikneldstltfrrscregicgscamniaggnt lactkkidpdlskttkiyplphmyvvkdlvpdlsnfyaqyksiepylkkkdeskqgkeqy lqsiedrqkldglyecilcaccstscpsywwngdkylgpavlmqayrwmidsrddyteer laqlqdpfslyrchtimnctrtcpkglnpgkaiaeikkmmatykekaaaa >Bos (incomplete? aligns w 104-242 of human): ninggntlactrridtnlskvskiyplphmyvikdlvpdlsnfyaqyksiepylkkkdes qggkeqylqsiedrekldglyecilcaccstscpsywwngdkylgpavlmqayrwmidsr ddfteerlaklqdpfslyr
Alignment, Vertical, Chicken NA alignment w translation bos cytb (30-169 is mature chain) 140 residues, mw 15,160 Da 1 maalllrhvg rhclrahlsp qlcirnavpl gttakeemer fwsknttlnr plsphisiyg 61 wslpmamsic hrgtgialsa gvslfglsal lvpgsfeshl efvkslclgp alihtakfal 121 vfplmyhtwn girhlmwdlg kgltisqlhq sgvavlvltv lssvglaam
Alignment [1-55 is transit peptide]56-159 is 103 residues, 10,997 Da QPS3bos 1 malwrlsvlc gakegralfl rtpvvrpalv saflqdrpaq gwcgtqhihl spshhsgska 61 aslhwtgerv vsvlllglip aaylnpcsam dyslaatltl hshwgigqvv tdyvhgdavq 121 kaaktgllvl saftfaglcy fnyhdvgick avamlwklKeywords: Complex II, Succinate dehydrogenase, SDH, cis-peptid,e x-ray structure, respiratory chain, Kreb's Cycle